Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0012_L07
         (188 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical pr...    25   7.5  
U80839-7|AAB37915.1|  306|Caenorhabditis elegans Hypothetical pr...    25   9.9  
M77697-7|AAA27902.6|  903|Caenorhabditis elegans Hypothetical pr...    25   9.9  

>Z79757-6|CAB02127.1|  350|Caenorhabditis elegans Hypothetical
           protein F55B12.6 protein.
          Length = 350

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +1

Query: 130 GTRFSFVCFYGTL 168
           GT FS VC+YG L
Sbjct: 228 GTSFSVVCYYGVL 240


>U80839-7|AAB37915.1|  306|Caenorhabditis elegans Hypothetical
           protein ZC204.9 protein.
          Length = 306

 Score = 24.6 bits (51), Expect = 9.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +3

Query: 144 VCLFLWNARCG 176
           +C+ LW ARCG
Sbjct: 60  ICVHLWTARCG 70


>M77697-7|AAA27902.6|  903|Caenorhabditis elegans Hypothetical
           protein B0303.11 protein.
          Length = 903

 Score = 24.6 bits (51), Expect = 9.9
 Identities = 15/48 (31%), Positives = 19/48 (39%)
 Frame = +1

Query: 43  YLFDLILKGRSINLLLRSDSLFPSDPA*TGTRFSFVCFYGTLVVVLHM 186
           YLF   L    + L+  SD   PS P       S  CF  +L    H+
Sbjct: 374 YLFAYALFNFYVFLVKLSDPEIPSPPTLLSLAISAACFIASLYTNRHL 421


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,582,186
Number of Sequences: 27780
Number of extensions: 72166
Number of successful extensions: 143
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 143
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 12,740,198
effective HSP length: 42
effective length of database: 11,573,438
effective search space used: 231468760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)