Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0012_F15
         (496 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_07_0111 - 41137822-41138973,41139453-41139540,41139850-411399...    28   3.6  

>01_07_0111 - 41137822-41138973,41139453-41139540,41139850-41139969,
            41140165-41140211,41140796-41141029,41141305-41141505,
            41141506-41143407,41144140-41145303,41145574-41145879
          Length = 1737

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -1

Query: 295  PYIWN**STINIYALSPFALLIKLWEQELIKLLPHWNG-IFSLQEIT 158
            P  W   +T+ I+ L+P   +++L   E +++LP W G   SL+ IT
Sbjct: 1178 PDRWGRLATLEIFELAPALRILELGFWEDLEMLPEWLGQHVSLEYIT 1224


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,113,164
Number of Sequences: 37544
Number of extensions: 219984
Number of successful extensions: 307
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 303
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 307
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1035514020
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)