SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0011_P01
         (511 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    21   5.6  
AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.    21   5.6  
X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    21   9.8  
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    21   9.8  
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    21   9.8  

>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -2

Query: 123 GGASVIYRMPSPERQRLIIPSTDCYVRYIHLHVHNETY 10
           G A +IY+       RL   + D  +RY  L V  E++
Sbjct: 211 GDALIIYQNSDDSFHRLTSKTFDNDLRYSELAVAGESF 248


>AB022907-1|BAA86908.1|  615|Apis mellifera glucose oxidase protein.
          Length = 615

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +1

Query: 232 GAVVASQNKLY*GSDI*YKY 291
           GA + S  +LY G D+ +KY
Sbjct: 107 GAEIPSNLQLYLGGDLDWKY 126


>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 143 HDRCPDLIS 169
           HD CPD++S
Sbjct: 62  HDMCPDVMS 70


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 143 HDRCPDLIS 169
           HD CPD++S
Sbjct: 67  HDMCPDVMS 75


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 20.6 bits (41), Expect = 9.8
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +2

Query: 143 HDRCPDLIS 169
           HD CPD++S
Sbjct: 67  HDMCPDVMS 75


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,753
Number of Sequences: 438
Number of extensions: 3418
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14109465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -