BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0011_M14
(563 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.6
DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 3.7
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 23.4 bits (48), Expect = 1.6
Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 1/48 (2%)
Frame = +3
Query: 210 CLGTGSFT-QIIGIHYPIELRSLPL*THGRG*LREFIYMITKLTPTME 350
CL T F Q+ ++ I+ PL HG+ REF Y P +
Sbjct: 277 CLSTRLFYYQLTDLYKKIKKAVPPLSLHGQLLWREFFYCAATKNPNFD 324
>DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein.
Length = 145
Score = 22.2 bits (45), Expect = 3.7
Identities = 6/11 (54%), Positives = 7/11 (63%)
Frame = -2
Query: 52 CSPGIHCSRAP 20
CSP +HC P
Sbjct: 16 CSPSVHCGTRP 26
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,837
Number of Sequences: 438
Number of extensions: 2763
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16317903
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -