SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0011_F17
         (515 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF065522-1|ABK59322.1|  255|Anopheles gambiae beta carbonic anhy...    23   8.1  

>EF065522-1|ABK59322.1|  255|Anopheles gambiae beta carbonic
           anhydrase protein.
          Length = 255

 Score = 22.6 bits (46), Expect = 8.1
 Identities = 11/46 (23%), Positives = 19/46 (41%)
 Frame = -2

Query: 508 HVISLQNSFFSVSPCIFYIAFIAASMSHLISWWTGSIDCNDNSSTY 371
           H    Q+ +FS  P    +  +  ++ H+I    G  DC   +  Y
Sbjct: 69  HAEHFQDEYFSCEPAALELGCVVNNIKHIIV--CGHSDCKAMNLLY 112


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 531,559
Number of Sequences: 2352
Number of extensions: 9348
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 46937349
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -