BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0011_F02
(412 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q9CGN2 Cluster: Putative uncharacterized protein ykhH; ... 31 6.9
>UniRef50_Q9CGN2 Cluster: Putative uncharacterized protein ykhH;
n=1; Lactococcus lactis subsp. lactis|Rep: Putative
uncharacterized protein ykhH - Lactococcus lactis subsp.
lactis (Streptococcus lactis)
Length = 121
Score = 31.5 bits (68), Expect = 6.9
Identities = 13/41 (31%), Positives = 24/41 (58%)
Frame = +3
Query: 252 LTIYRLTKCLRNPIWNILTMTTTIIMGVKMIVIWKQSIVVN 374
L + LT +RN + T + II G+ ++++W+Q +V N
Sbjct: 50 LVLGLLTGAIRNQERILTTFISLIIFGLPLLILWQQKVVFN 90
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 295,922,932
Number of Sequences: 1657284
Number of extensions: 4210649
Number of successful extensions: 10392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10371
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 18619342852
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -