Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0011_C14
         (424 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT023916-1|ABA81850.1| 1062|Drosophila melanogaster AT08232p pro...    28   5.9  

>BT023916-1|ABA81850.1| 1062|Drosophila melanogaster AT08232p protein.
          Length = 1062

 Score = 27.9 bits (59), Expect = 5.9
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 63   TKHKTTFLDKIITCTSQMYAITFNYNRKYFTNFLFLNLYKIINS-VSQFFKSHSIEVIIV 239
            T  KTTF+     C+ ++  I  NY   +     F +L++ INS V    +  + + I++
Sbjct: 987  TPEKTTFVQISENCSDKVNVIVLNYINTWRNIGNFTDLHQAINSMVPNATEVRNKDSILL 1046

Query: 240  FFV 248
            ++V
Sbjct: 1047 YYV 1049


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,605,071
Number of Sequences: 53049
Number of extensions: 288923
Number of successful extensions: 563
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 555
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 563
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1292733852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)