SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0011_C01
         (376 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                22   2.7  
AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    20   8.3  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    20   8.3  
AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cycl...    20   8.3  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    20   8.3  
AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cycl...    20   8.3  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 21.8 bits (44), Expect = 2.7
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = +3

Query: 144 SCRTGCMHPSGGGGQPPAEQEYGHT*SHLH 233
           +C +  ++PS  G  PP+   + H  S  H
Sbjct: 298 ACHSPGVYPSTAGFLPPSYHPHQHHPSQYH 327


>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
           protein.
          Length = 1370

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 8/18 (44%), Positives = 9/18 (50%), Gaps = 1/18 (5%)
 Frame = -2

Query: 156 RCDTTQHFHGSFLVQ-WK 106
           RC    HF  SF  Q W+
Sbjct: 72  RCSDVHHFESSFNAQSWQ 89


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = -3

Query: 227 MALSVAIFLFCW 192
           +A+ + +FL CW
Sbjct: 621 LAIVLGVFLICW 632


>AY769960-1|AAV34676.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 113 SGNCKLN 93
           SGNCKLN
Sbjct: 243 SGNCKLN 249


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = -3

Query: 116 YSGNCKLNIYYF 81
           Y  +C++N+ YF
Sbjct: 154 YKSSCEINVEYF 165


>AB181489-1|BAD22772.1|  603|Apis mellifera soluble guanylyl cyclase
           beta 1 subunit protein.
          Length = 603

 Score = 20.2 bits (40), Expect = 8.3
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 113 SGNCKLN 93
           SGNCKLN
Sbjct: 243 SGNCKLN 249


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,779
Number of Sequences: 438
Number of extensions: 2355
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9052365
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -