BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0010_O17
(611 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 23 2.4
U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 9.5
DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.5
AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 9.5
>DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large
subunit protein.
Length = 296
Score = 23.0 bits (47), Expect = 2.4
Identities = 9/43 (20%), Positives = 21/43 (48%)
Frame = +3
Query: 219 FARRKRKWRVLHLKEIWTGSPWRSCLLKDEDALHLRQVQALVL 347
F +++ +L W G + C+LK + +Q+ +L++
Sbjct: 15 FIEKEQMMNILMFLPSWDGKMPQPCILKPKPLWTGKQISSLII 57
>U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin
protein.
Length = 377
Score = 21.0 bits (42), Expect = 9.5
Identities = 5/12 (41%), Positives = 10/12 (83%)
Frame = -2
Query: 442 TYLLCHALWGHF 407
+YL+C+ +W +F
Sbjct: 215 SYLVCYGIWVYF 226
>DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor
2 protein.
Length = 581
Score = 21.0 bits (42), Expect = 9.5
Identities = 6/9 (66%), Positives = 7/9 (77%)
Frame = +1
Query: 472 PTACGEWSS 498
P CG+WSS
Sbjct: 364 PNCCGKWSS 372
>AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength
rhodopsin protein.
Length = 154
Score = 21.0 bits (42), Expect = 9.5
Identities = 5/12 (41%), Positives = 10/12 (83%)
Frame = -2
Query: 442 TYLLCHALWGHF 407
+YL+C+ +W +F
Sbjct: 91 SYLVCYGIWVYF 102
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,626
Number of Sequences: 438
Number of extensions: 3203
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -