SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0010_O17
         (611 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II lar...    23   2.4  
U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodops...    21   9.5  
DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like recept...    21   9.5  
AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength rhodo...    21   9.5  

>DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II large
           subunit protein.
          Length = 296

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 9/43 (20%), Positives = 21/43 (48%)
 Frame = +3

Query: 219 FARRKRKWRVLHLKEIWTGSPWRSCLLKDEDALHLRQVQALVL 347
           F  +++   +L     W G   + C+LK +     +Q+ +L++
Sbjct: 15  FIEKEQMMNILMFLPSWDGKMPQPCILKPKPLWTGKQISSLII 57


>U26026-1|AAA69069.1|  377|Apis mellifera long-wavelength rhodopsin
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = -2

Query: 442 TYLLCHALWGHF 407
           +YL+C+ +W +F
Sbjct: 215 SYLVCYGIWVYF 226


>DQ869051-1|ABJ09598.1|  581|Apis mellifera pyrokinin-like receptor
           2 protein.
          Length = 581

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +1

Query: 472 PTACGEWSS 498
           P  CG+WSS
Sbjct: 364 PNCCGKWSS 372


>AF091732-1|AAD02869.2|  154|Apis mellifera long-wavelength
           rhodopsin protein.
          Length = 154

 Score = 21.0 bits (42), Expect = 9.5
 Identities = 5/12 (41%), Positives = 10/12 (83%)
 Frame = -2

Query: 442 TYLLCHALWGHF 407
           +YL+C+ +W +F
Sbjct: 91  SYLVCYGIWVYF 102


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,626
Number of Sequences: 438
Number of extensions: 3203
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18093444
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -