BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0010_L05
(450 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.0
AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 2.7
>AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein.
Length = 247
Score = 22.6 bits (46), Expect = 2.0
Identities = 11/42 (26%), Positives = 22/42 (52%)
Frame = -3
Query: 307 IVFYLYIKYYFL*NNNTMNQKMLEI*PTIHIQADFEINGNNL 182
++ Y+Y Y L + + +K E I ++++NGNN+
Sbjct: 122 LIAYIYHLYMGLLSGGIILRKKREFMQKIWPFKEYQMNGNNI 163
>AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein.
Length = 898
Score = 22.2 bits (45), Expect = 2.7
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 390 SHNCIPFNILFII 428
S+NC+P N+ F +
Sbjct: 693 SYNCVPINVQFSV 705
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,075
Number of Sequences: 438
Number of extensions: 2674
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -