SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0010_J12
         (473 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    28   0.14 
AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small...    23   4.1  
AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.2  
AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.2  
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            23   7.2  

>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 28.3 bits (60), Expect = 0.14
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -1

Query: 113 APVLSAQLITAPTGRPSEMRNFAPAEPPRPLLDILP 6
           APV+ + ++TAP  RPS+      A  PR  +  +P
Sbjct: 91  APVVPSSVVTAPPARPSQPPTTRFAPEPRAEVKFVP 126


>AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small
           GTPase protein.
          Length = 190

 Score = 23.4 bits (48), Expect = 4.1
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 279 SKWFPLPDHHC 247
           SKW+P   HHC
Sbjct: 98  SKWYPEIKHHC 108


>AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 273 WFPLPDHHC 247
           WFP  D HC
Sbjct: 154 WFPFDDQHC 162


>AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -3

Query: 273 WFPLPDHHC 247
           WFP  D HC
Sbjct: 154 WFPFDDQHC 162


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 9/30 (30%), Positives = 15/30 (50%)
 Frame = -1

Query: 113  APVLSAQLITAPTGRPSEMRNFAPAEPPRP 24
            A  +S+     P  +P++    +PAE P P
Sbjct: 951  ASYVSSNATVVPATQPADASQASPAEEPLP 980


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 541,794
Number of Sequences: 2352
Number of extensions: 11753
Number of successful extensions: 24
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -