SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0010_F07
         (457 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    22   2.7  
DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protei...    21   4.8  
DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex det...    21   6.3  
DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex det...    21   6.3  
AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex det...    21   6.3  
AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex det...    21   6.3  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 8/21 (38%), Positives = 16/21 (76%)
 Frame = +3

Query: 333 RLNRSEEAFQELNKKSSALKK 395
           +LN+  +A+++LN++  AL K
Sbjct: 75  KLNKIHDAYKDLNQRYGALCK 95


>DQ257631-1|ABB82366.1|  424|Apis mellifera yellow e3-like protein
           protein.
          Length = 424

 Score = 21.4 bits (43), Expect = 4.8
 Identities = 10/37 (27%), Positives = 18/37 (48%)
 Frame = +3

Query: 210 VPGLNYDLVAGIMRRADIPVNMNESLLRLQGTLTEAE 320
           + G  +DL+ GI+  A  P+  N+ +L      +  E
Sbjct: 237 IKGDTFDLMDGILGLALGPIRNNDRILYFHSLASRVE 273


>DQ325133-1|ABD14147.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325075-1|ABD14089.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325074-1|ABD14088.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325073-1|ABD14087.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325072-1|ABD14086.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325071-1|ABD14085.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325070-1|ABD14084.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325069-1|ABD14083.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>DQ325068-1|ABD14082.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 101 YNKHNYNKLYYN 112


>AY569696-1|AAS86649.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 334 YNKHNYNKLYYN 345


>AY569695-1|AAS86648.1|  414|Apis mellifera complementary sex
           determiner protein.
          Length = 414

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 47  YEKEQYNILFYN 12
           Y K  YN L+YN
Sbjct: 334 YNKHNYNKLYYN 345


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,181
Number of Sequences: 438
Number of extensions: 1632
Number of successful extensions: 13
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12066642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -