Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0010_B20
         (500 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens ...    29   9.1  

>AK127075-1|BAC86814.1| 1332|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45132 fis, clone BRAWH3037979, highly  similar
           to Ubiquitin carboxyl-terminal hydrolase 24 (EC
           3.1.2.15). ).
          Length = 1332

 Score = 29.1 bits (62), Expect = 9.1
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +1

Query: 121 TSLSTE*RHDSRYLSAVISTSVL*KWSTFSATKAATLRLLSPCGDASDL 267
           TS   + +  +++L  VI T+ L  WS  S  +    RLLS C +  DL
Sbjct: 716 TSAHPDVQKPNQFLLGVILTAQLPLWSPTSIMRGVNQRLLSQCMEYFDL 764


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,145,531
Number of Sequences: 237096
Number of extensions: 1400228
Number of successful extensions: 3420
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3335
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3420
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4593178062
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)