BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0009_M01
(350 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF003390-5|AAB54270.2| 873|Caenorhabditis elegans Hypothetical ... 26 6.6
>AF003390-5|AAB54270.2| 873|Caenorhabditis elegans Hypothetical
protein R155.4 protein.
Length = 873
Score = 26.2 bits (55), Expect = 6.6
Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Frame = -3
Query: 291 LELTSSTKLL-DLSIIIKLRYTILRKRNKMKXXXXXXXXXNEIVDSKIVIAIIGHTSNSL 115
L +TS K+L D+ +K T + K+N K E+ ++ + +++IG + +
Sbjct: 561 LVITSVAKILPDIKKDMKNLQTFVSKKNSNKTKESSVDILKELKNATVQLSVIGSVARGI 620
Query: 114 AR 109
R
Sbjct: 621 FR 622
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,674,931
Number of Sequences: 27780
Number of extensions: 109531
Number of successful extensions: 242
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 241
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 242
length of database: 12,740,198
effective HSP length: 72
effective length of database: 10,740,038
effective search space used: 472561672
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -