Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0009_C24
         (491 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0340 + 24517562-24520318                                         29   2.7  

>04_04_0340 + 24517562-24520318
          Length = 918

 Score = 28.7 bits (61), Expect = 2.7
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +1

Query: 220 KNLKDLPSLCKELMVYNNLDIEVEMYIQKVTELDKNVLQWAIDLTERNMRSLYE 381
           K LK +  L  E    NN     ++ ++   E+  N LQ A+DL +RN   +YE
Sbjct: 195 KLLKTINHLVSEAAARNNKSENYKILVKIDAEV--NCLQDALDLIDRNKNEVYE 246


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,397,049
Number of Sequences: 37544
Number of extensions: 229428
Number of successful extensions: 508
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 502
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 508
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1023611560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)