BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0008_M13
(239 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ535285-1|ABF83228.1| 126|Homo sapiens circulating B cell anti... 28 6.1
>DQ535285-1|ABF83228.1| 126|Homo sapiens circulating B cell
antibody heavy chain variable region protein.
Length = 126
Score = 27.9 bits (59), Expect = 6.1
Identities = 13/31 (41%), Positives = 20/31 (64%)
Frame = -2
Query: 178 KETGENVVTSRKSNTYTIQGMYYLGYNRERP 86
K+ G +V SRK++ YT G YY+ + R+ P
Sbjct: 14 KKPGASVKVSRKASGYTFTG-YYMHWVRQAP 43
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,021,802
Number of Sequences: 237096
Number of extensions: 523086
Number of successful extensions: 922
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 917
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 922
length of database: 76,859,062
effective HSP length: 58
effective length of database: 63,107,494
effective search space used: 1325257374
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -