SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0008_M13
         (239 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    20   4.9  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    20   4.9  
DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.              19   8.5  
AF388659-3|AAK71993.1|  548|Apis mellifera 1D-myo-inositol-trisp...    19   8.5  

>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 19.8 bits (39), Expect = 4.9
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = +3

Query: 114 YIPCIVYVLDFLDV 155
           YIPCI+ V  + ++
Sbjct: 353 YIPCIIMVFLYYNI 366


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 19.8 bits (39), Expect = 4.9
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = +1

Query: 121 PVLYMCW 141
           PV+Y CW
Sbjct: 387 PVIYACW 393


>DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.
          Length = 135

 Score = 19.0 bits (37), Expect = 8.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +2

Query: 110 IIHSLYCICVG 142
           +I S  CICVG
Sbjct: 5   LIISAICICVG 15


>AF388659-3|AAK71993.1|  548|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform C protein.
          Length = 548

 Score = 19.0 bits (37), Expect = 8.5
 Identities = 10/52 (19%), Positives = 19/52 (36%)
 Frame = +1

Query: 40  LTNNKVLLFRCTLRCVVVHGCTLNNTFPVLYMCWIFSMLQRFRLFPYVTINW 195
           L N+++  ++  L+C        N     L  C  +    R    P + + W
Sbjct: 136 LRNDRIDSYKSNLKCDKCSTYQSNGEEVCLENCTGYQQYLRLLEVPQINLEW 187


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 67,692
Number of Sequences: 438
Number of extensions: 1361
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 47
effective length of database: 125,757
effective search space used:  4024224
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)

- SilkBase 1999-2023 -