SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0008_I10
         (474 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                24   0.95 
AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    21   5.1  
AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.          21   8.9  

>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 23.8 bits (49), Expect = 0.95
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 1   CCRNSARGKILVVGNPANTNALICSKYAPSIPKENFTAM 117
           C + S+ G+  V  +P   NAL+ +  AP++P E    M
Sbjct: 24  CLQESSTGQS-VEFSPMELNALVGTPAAPNMPAEEGEGM 61


>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 21.4 bits (43), Expect = 5.1
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +3

Query: 255 YWWS*KISTGSY***GLLKE 314
           +WW+ KIS  S+    LLKE
Sbjct: 366 WWWNMKISNLSFDKQSLLKE 385


>AF134821-1|AAD40236.1|  226|Apis mellifera hexamerin protein.
          Length = 226

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 5/8 (62%), Positives = 5/8 (62%)
 Frame = +3

Query: 243 CCRDYWWS 266
           CC   WWS
Sbjct: 200 CCTTXWWS 207


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.132    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,537
Number of Sequences: 438
Number of extensions: 2042
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12805416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -