Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0007_H02
         (437 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370046-1|ABD18607.1|  125|Anopheles gambiae putative secreted ...    24   2.7  
AJ302658-1|CAC35523.1|  145|Anopheles gambiae gSG7 protein protein.    23   3.6  

>DQ370046-1|ABD18607.1|  125|Anopheles gambiae putative secreted
           polypeptide protein.
          Length = 125

 Score = 23.8 bits (49), Expect = 2.7
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 249 GHCLPKLFTRRGP 287
           G C+PKLF +R P
Sbjct: 100 GRCIPKLFCQRPP 112


>AJ302658-1|CAC35523.1|  145|Anopheles gambiae gSG7 protein protein.
          Length = 145

 Score = 23.4 bits (48), Expect = 3.6
 Identities = 9/36 (25%), Positives = 17/36 (47%)
 Frame = +1

Query: 292 NTGQGPQFDDHCPSRTVAILLELSRLFYGTSKFTCY 399
           N  +  +  D C  + VA + +L   FY +  + C+
Sbjct: 74  NLPKSAKLSDGCLKQMVARVTDLEASFYASFSYNCH 109


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 406,249
Number of Sequences: 2352
Number of extensions: 6570
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 36568146
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)