Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0007_G19
         (474 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.     22   9.5  
AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.           22   9.5  
AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.           22   9.5  
AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.           22   9.5  
AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.           22   9.5  
AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.           22   9.5  
AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsi...    22   9.5  
AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.           22   9.5  

>AY462096-1|AAS21248.1|  603|Anopheles gambiae transposase protein.
          Length = 603

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 4/34 (11%)
 Frame = +1

Query: 97  AVNVVSAQRIINIDN----CNLKLLSIT*IFSNE 186
           A N+VSAQ+ I I +    CN+ LL+ T  F N+
Sbjct: 380 ATNIVSAQKYITISHVGLLCNV-LLTKTSQFRND 412


>AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 185 FFNDEKLYLDKS 196


>AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 185 FFNDEKLYLDKS 196


>AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 185 FFNDEKLYLDKS 196


>AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 185 FFNDEKLYLDKS 196


>AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 185 FFNDEKLYLDKS 196


>AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsive
           serine proteaselike protein protein.
          Length = 600

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +2

Query: 260 CRQKQLPWKIQSQVV 304
           C QKQ+P+ + ++VV
Sbjct: 560 CHQKQIPYTVLTKVV 574


>AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.
          Length = 576

 Score = 22.2 bits (45), Expect = 9.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 237 YFNHQKLYVDKN 272
           +FN +KLY+DK+
Sbjct: 412 FFNDEKLYLDKS 423


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 458,532
Number of Sequences: 2352
Number of extensions: 8763
Number of successful extensions: 65
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 64
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 65
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41670678
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)