BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0007_G19
(474 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z83109-4|CAB05519.1| 705|Caenorhabditis elegans Hypothetical pr... 27 9.1
Z47811-2|CAA87786.2| 1307|Caenorhabditis elegans Hypothetical pr... 27 9.1
>Z83109-4|CAB05519.1| 705|Caenorhabditis elegans Hypothetical
protein F44G3.7 protein.
Length = 705
Score = 26.6 bits (56), Expect = 9.1
Identities = 10/32 (31%), Positives = 21/32 (65%)
Frame = +2
Query: 227 LFIIFQPPKTLCRQKQLPWKIQSQVVITEVLK 322
LFI F+PP+ + ++K + K+ + ++ T+ K
Sbjct: 435 LFIYFEPPEDVDKEKSINPKMFANILATDCFK 466
>Z47811-2|CAA87786.2| 1307|Caenorhabditis elegans Hypothetical protein
K02C4.3 protein.
Length = 1307
Score = 26.6 bits (56), Expect = 9.1
Identities = 11/13 (84%), Positives = 13/13 (100%)
Frame = -2
Query: 185 SLENIHVILSNFK 147
SLENIHVIL++FK
Sbjct: 1076 SLENIHVILNDFK 1088
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,139,494
Number of Sequences: 27780
Number of extensions: 192697
Number of successful extensions: 366
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 366
length of database: 12,740,198
effective HSP length: 76
effective length of database: 10,628,918
effective search space used: 860942358
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -