Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0006_P24
         (534 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF038614-7|AAB92060.2|  664|Caenorhabditis elegans Hypothetical ...    27   8.5  

>AF038614-7|AAB92060.2|  664|Caenorhabditis elegans Hypothetical
           protein F15E6.9 protein.
          Length = 664

 Score = 27.1 bits (57), Expect = 8.5
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +1

Query: 100 ITLYVYDCEIEINFNDIFELKFLWNVIYYRMETKSFNCLLGIFSYHTYVYINT*HKIKEI 279
           +  Y+   +I +NF + F++K   + I      ++FNC   IFS    ++IN     KE 
Sbjct: 336 VVRYLLVDDIHLNFCENFKVKITLSQIL-----QNFNCFAQIFSLLKQIFINFFQASKEA 390

Query: 280 RK 285
           ++
Sbjct: 391 QQ 392


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,330,368
Number of Sequences: 27780
Number of extensions: 238675
Number of successful extensions: 635
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 614
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 635
length of database: 12,740,198
effective HSP length: 77
effective length of database: 10,601,138
effective search space used: 1060113800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)