SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0006_P22
         (573 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    23   2.8  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    21   8.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    21   8.7  

>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 3/52 (5%)
 Frame = +1

Query: 43  WYQEEYQFDGFRFDGVTSMLYHSRGI---GEGFSGHYDEYYGLNVDTEALVY 189
           W   ++Q+D   + GVT +   S  I         + D  YG+   T+A+++
Sbjct: 77  WQDHKFQWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYGVTTMTKAILH 128


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +1

Query: 106  HSRGIGEGFSGHYD 147
            HS GI +G+  HY+
Sbjct: 1139 HSNGIIQGYKLHYE 1152


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 21.0 bits (42), Expect = 8.7
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +1

Query: 106  HSRGIGEGFSGHYD 147
            HS GI +G+  HY+
Sbjct: 1135 HSNGIIQGYKLHYE 1148


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,896
Number of Sequences: 438
Number of extensions: 3748
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16504155
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -