SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0006_L11
         (517 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1300 + 29154942-29154997,29155390-29155554,29156169-291562...    27   8.9  

>06_03_1300 +
           29154942-29154997,29155390-29155554,29156169-29156246,
           29156353-29156632,29156809-29157258
          Length = 342

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = -2

Query: 237 WIFYEYRTLLGPHYSFLP*SKEIFEFDFLQESIYI 133
           W F+ +R   G  +  LP  K +F F  L  ++YI
Sbjct: 279 WWFHSFRIKFGKVHVVLPSGKVMFLFSLLFSTLYI 313


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,880,060
Number of Sequences: 37544
Number of extensions: 150105
Number of successful extensions: 257
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 255
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 257
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1118831240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -