SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0006_L11
         (517 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.          24   1.1  
AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.      24   1.1  
EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.          21   5.7  
EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.      21   5.7  
DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channe...    21   7.5  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   7.5  

>EF625896-1|ABR45903.1|  683|Apis mellifera hexamerin protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 388 PKIRNRFYFLLHQ 426
           P+IR  FYF LH+
Sbjct: 251 PQIRGEFYFFLHK 263


>AY601637-1|AAT11850.1|  683|Apis mellifera hexamerin 70b protein.
          Length = 683

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 388 PKIRNRFYFLLHQ 426
           P+IR  FYF LH+
Sbjct: 251 PQIRGEFYFFLHK 263


>EF625897-1|ABR45904.1|  684|Apis mellifera hexamerin protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -2

Query: 339 FYPMYYNRMKYIN 301
           FYP YY  M Y N
Sbjct: 291 FYPGYYPTMTYSN 303


>EF591128-1|ABQ59246.1|  684|Apis mellifera hexamerin 70a protein.
          Length = 684

 Score = 21.4 bits (43), Expect = 5.7
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -2

Query: 339 FYPMYYNRMKYIN 301
           FYP YY  M Y N
Sbjct: 291 FYPGYYPTMTYSN 303


>DQ667183-1|ABG75735.1|  463|Apis mellifera GABA-gated ion channel
           protein.
          Length = 463

 Score = 21.0 bits (42), Expect = 7.5
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = +1

Query: 409 YFLLHQFYHLQKFLYNFV 462
           Y +L  ++HLQ+ + NF+
Sbjct: 200 YSMLLVYFHLQRHMGNFL 217


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.0 bits (42), Expect = 7.5
 Identities = 11/39 (28%), Positives = 18/39 (46%)
 Frame = +3

Query: 360 LLFIQPIMNPKNTQQILFFTSSVLPPTKISL*FRRLHQY 476
           L+   P+M PK   ++     S+L     +L  R +H Y
Sbjct: 430 LISWNPLMQPKQPIKLFEQWKSILESGTTTLQTRTMHPY 468


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,173
Number of Sequences: 438
Number of extensions: 2287
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14354847
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -