SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0006_E24
         (468 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    23   2.2  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    23   2.2  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   5.0  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   6.6  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 434 EYSCFKIKLLVKK 396
           EYSC K+ LL K+
Sbjct: 227 EYSCLKVDLLFKR 239


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -2

Query: 434 EYSCFKIKLLVKK 396
           EYSC K+ LL K+
Sbjct: 227 EYSCLKVDLLFKR 239


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.4 bits (43), Expect = 5.0
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = -1

Query: 198 STAQHLQQPLSVWLRFSXXXXXXXHLPG*GRSKHKLIQLLM 76
           S++   ++P S+  R S        + G  + KHK+  LLM
Sbjct: 107 SSSSDDERPNSIHQRASFSLNTDGDIAGLRKKKHKVNPLLM 147


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = -1

Query: 228 PPRPLQIDQASTAQHLQQPLSV 163
           PP   Q D +S+++  + P+SV
Sbjct: 441 PPLSPQSDSSSSSRSAESPMSV 462


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,169
Number of Sequences: 438
Number of extensions: 1535
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12559158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -