Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0005_H23
         (239 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   1.6  
DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    19   6.4  

>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 1.6
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 126 SSEFSKFSPIIRRTTSNQKRSKSELRCFFSKLMSPSCRI 10
           SSEFSK S + R T+   ++  + ++   +    P  R+
Sbjct: 3   SSEFSKISKVDRSTSPLPRKPVNPVQELKALFAEPPVRV 41


>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 19.4 bits (38), Expect = 6.4
 Identities = 5/10 (50%), Positives = 6/10 (60%)
 Frame = +1

Query: 136 CCCQC*SQIG 165
           CCC C   +G
Sbjct: 11  CCCWCCDNLG 20


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,282
Number of Sequences: 438
Number of extensions: 918
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 47
effective length of database: 125,757
effective search space used:  4024224
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 37 (19.9 bits)