Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0005_G17
         (430 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    23   1.9  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    22   3.3  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    22   3.3  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   5.8  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    21   7.7  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   7.7  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 22.6 bits (46), Expect = 1.9
 Identities = 11/49 (22%), Positives = 22/49 (44%)
 Frame = +2

Query: 152 KRLPNINVATTSISSQITVCGDLHGKLDDLLVIFHKNGLPSPENPYIFN 298
           K LP   +   +++  +       G +   +VI+    + +P N Y+FN
Sbjct: 26  KYLPLTLIVPITLTYVVIFVTGFVGNIITCIVIWRNPSMQTPTNYYLFN 74


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +3

Query: 336 YFFCYWRACW 365
           Y  C+W+ CW
Sbjct: 486 YPCCWWKICW 495


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +3

Query: 336 YFFCYWRACW 365
           Y  C+W+ CW
Sbjct: 539 YPCCWWKICW 548


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.0 bits (42), Expect = 5.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +2

Query: 71  IEAFRKKKHRLHP 109
           I   RKKKH+++P
Sbjct: 132 IAGLRKKKHKVNP 144


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 20.6 bits (41), Expect = 7.7
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -1

Query: 328 PFFTTIHKVTV 296
           P FTT+H++ +
Sbjct: 321 PLFTTVHRICI 331


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 20.6 bits (41), Expect = 7.7
 Identities = 9/23 (39%), Positives = 16/23 (69%), Gaps = 1/23 (4%)
 Frame = +2

Query: 53  KDIDLLIEAFRKKKHR-LHPKHI 118
           K + ++ +A +KKKHR + P+ I
Sbjct: 618 KTVQVIEDAAQKKKHRAIRPEPI 640


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,401
Number of Sequences: 438
Number of extensions: 3401
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11121030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)