SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0005_E01
         (576 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0199 - 12559351-12559433,12559693-12559827,12560260-125604...    33   0.22 

>04_03_0199 -
           12559351-12559433,12559693-12559827,12560260-12560437,
           12560848-12561389,12561398-12564827
          Length = 1455

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -2

Query: 452 SCYHGTPHNNPKWYLTSNT*LQASRCQNCAIT*T*N-ENLLDIRRP**VIL*NENLLDIR 276
           S Y+GT    P W  TS T LQ  R +NCA   T + E L  +R+   + + N ++L IR
Sbjct: 743 SWYNGT--KAPTWLSTSLTYLQTLRLENCAEWHTLSLEGLSLLRKLVLIEMKNASVLSIR 800

Query: 275 RPQ 267
            PQ
Sbjct: 801 SPQ 803


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,987,237
Number of Sequences: 37544
Number of extensions: 252719
Number of successful extensions: 280
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 277
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 280
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1340735508
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -