BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0005_E01
(576 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE013599-3366|AAF46825.1| 727|Drosophila melanogaster CG3382-PA... 29 6.0
>AE013599-3366|AAF46825.1| 727|Drosophila melanogaster CG3382-PA
protein.
Length = 727
Score = 28.7 bits (61), Expect = 6.0
Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
Frame = +3
Query: 366 TILASASL*L-SVRGEVPLWIIMGGTMVATFYRLTLCPYIDIG 491
T+ +SA L + RG P W+ +G ++A F L L P+I G
Sbjct: 143 TVFSSAFLSYYASRGHRPRWVALGLIIIAIFCLLMLTPHIFYG 185
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,699,986
Number of Sequences: 53049
Number of extensions: 441652
Number of successful extensions: 609
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 598
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 609
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2276053890
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -