Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0005_C03
         (526 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP22H7.07 |prp5|cwf1|WD repeat protein Prp5|Schizosaccharomyce...    25   5.2  
SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizo...    25   9.1  

>SPBP22H7.07 |prp5|cwf1|WD repeat protein Prp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 473

 Score = 25.4 bits (53), Expect = 5.2
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +2

Query: 191 GVAAAPRHPYLY 226
           G+A +PRHPYL+
Sbjct: 210 GLAVSPRHPYLF 221


>SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 944

 Score = 24.6 bits (51), Expect = 9.1
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%)
 Frame = +2

Query: 110 TRRRVSISSPNPPGSLSFP--LHDSPLPTGVAAAPRH 214
           +R R    S N   +LS P   H SP P+ V A+ RH
Sbjct: 121 SRGRHMAFSKNDGTNLSLPPSRHQSPPPSSVLASQRH 157


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,599,184
Number of Sequences: 5004
Number of extensions: 23596
Number of successful extensions: 87
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 86
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 214353836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)