Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0005_B12
         (342 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces pombe...    27   1.1  
SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyce...    23   9.8  

>SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 568

 Score = 26.6 bits (56), Expect = 1.1
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +1

Query: 304 CRPWWSCYGNYDF 342
           C PW  CYG Y F
Sbjct: 100 CCPWAQCYGGYQF 112


>SPBC14F5.07 |||ER-localized ubiquitin ligase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1242

 Score = 23.4 bits (48), Expect = 9.8
 Identities = 12/36 (33%), Positives = 19/36 (52%)
 Frame = -1

Query: 159 EFRIYYQEVRNVKIHQEFQLLKFKREDEIF*VILAD 52
           E  IYY +  + ++ Q F +    R  ++F VIL D
Sbjct: 566 ESLIYYMKTGHKQVVQSFSIFPVFRVCQMFAVILKD 601


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,202,605
Number of Sequences: 5004
Number of extensions: 18337
Number of successful extensions: 36
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 2,362,478
effective HSP length: 64
effective length of database: 2,042,222
effective search space used: 100068878
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)