Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0004_O10
         (496 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   4.3  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    23   4.3  
AJ302654-1|CAC35519.1|  168|Anopheles gambiae gSG2-like protein ...    23   5.7  

>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.4 bits (48), Expect = 4.3
 Identities = 14/33 (42%), Positives = 15/33 (45%)
 Frame = +3

Query: 159 SSLFSSPKAYISCSCNGSGGLPSFSGGTQCIRG 257
           SS  SS  +   C  NG GG    SGG   I G
Sbjct: 799 SSSSSSASSTSLCGGNGGGGGAGASGGGFLITG 831


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.4 bits (48), Expect = 4.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +3

Query: 201 CNGSGGLPSFSG 236
           CNG+ GLP  SG
Sbjct: 182 CNGTDGLPGLSG 193


>AJ302654-1|CAC35519.1|  168|Anopheles gambiae gSG2-like protein
           protein.
          Length = 168

 Score = 23.0 bits (47), Expect = 5.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 207 GSGGLPSFSGGTQ 245
           G GG+PSF  G Q
Sbjct: 124 GQGGIPSFGSGQQ 136


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 408,115
Number of Sequences: 2352
Number of extensions: 6749
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 43977336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)