SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0004_N19
         (417 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.     23   1.8  
DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor pro...    21   7.4  
DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor pro...    21   7.4  
AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    21   7.4  
DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholi...    20   9.7  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              20   9.7  

>AB194707-1|BAD69622.1|  247|Apis mellifera heme oxygenase protein.
          Length = 247

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 11/42 (26%), Positives = 22/42 (52%)
 Frame = -2

Query: 308 IVFYLYIKYYFL*NNNTMNQKMLEI*PTIHIQADFEINGNNL 183
           ++ Y+Y  Y  L +   + +K  E    I    ++++NGNN+
Sbjct: 122 LIAYIYHLYMGLLSGGIILRKKREFMQKIWPFKEYQMNGNNI 163


>DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 17  EIEPGNPC 40
           E+EPG PC
Sbjct: 181 ELEPGTPC 188


>DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 17  EIEPGNPC 40
           E+EPG PC
Sbjct: 181 ELEPGTPC 188


>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
           receptor protein.
          Length = 399

 Score = 20.6 bits (41), Expect = 7.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 17  EIEPGNPC 40
           E+EPG PC
Sbjct: 181 ELEPGTPC 188


>DQ026038-1|AAY87897.1|  520|Apis mellifera nicotinic acetylcholine
           receptor beta1subunit protein.
          Length = 520

 Score = 20.2 bits (40), Expect = 9.7
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = +2

Query: 122 LQLYIFYYIT 151
           LQLYIF+ +T
Sbjct: 481 LQLYIFFLVT 490


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 20.2 bits (40), Expect = 9.7
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = +1

Query: 391 SHNCIPFNI 417
           S+NC+P N+
Sbjct: 693 SYNCVPINV 701


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,318
Number of Sequences: 438
Number of extensions: 2364
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10626762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -