BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0004_I16
(550 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE013599-2065|AAM70972.1| 568|Drosophila melanogaster CG30469-P... 30 1.8
>AE013599-2065|AAM70972.1| 568|Drosophila melanogaster CG30469-PA
protein.
Length = 568
Score = 30.3 bits (65), Expect = 1.8
Identities = 14/33 (42%), Positives = 20/33 (60%)
Frame = +1
Query: 67 TILGRGKTCRFALLKWNVILAINLLSTTWNFRW 165
T+L GK C F + NV +A+ L+S + NF W
Sbjct: 20 TLLVYGKDCEFHSVIKNVDVAVVLVSDSMNFEW 52
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,030,699
Number of Sequences: 53049
Number of extensions: 317534
Number of successful extensions: 469
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 469
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2089831299
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -