SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0004_I09
         (467 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small...    23   4.0  
AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.0  
AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.0  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   7.0  

>AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small
           GTPase protein.
          Length = 190

 Score = 23.4 bits (48), Expect = 4.0
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 289 SKWFPLPDHHC 257
           SKW+P   HHC
Sbjct: 98  SKWYPEIKHHC 108


>AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 22.6 bits (46), Expect = 7.0
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -2

Query: 283 WFPLPDHHC 257
           WFP  D HC
Sbjct: 154 WFPFDDQHC 162


>AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 22.6 bits (46), Expect = 7.0
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = -2

Query: 283 WFPLPDHHC 257
           WFP  D HC
Sbjct: 154 WFPFDDQHC 162


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 22.6 bits (46), Expect = 7.0
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = -3

Query: 123 APVLSVAQLITAPTGRPSEMRNFAPAEPPRPLLDILLCPS 4
           APV+  + ++TAP  RPS+      A  P P  ++   PS
Sbjct: 91  APVVP-SSVVTAPPARPSQPPTTRFA--PEPRAEVKFVPS 127


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 546,312
Number of Sequences: 2352
Number of extensions: 12148
Number of successful extensions: 21
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 40820256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -