BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0004_F03
(463 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q8I2K6 Cluster: Putative uncharacterized protein PFI150... 33 2.3
>UniRef50_Q8I2K6 Cluster: Putative uncharacterized protein PFI1500w;
n=2; cellular organisms|Rep: Putative uncharacterized
protein PFI1500w - Plasmodium falciparum (isolate 3D7)
Length = 4530
Score = 33.5 bits (73), Expect = 2.3
Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 2/68 (2%)
Frame = -3
Query: 308 NIFVFIFTLIVK*PIVIIVSLQISCNRHCIRHTKV*SQSKIQFGNSKHSL--HSCITYIT 135
N FVFI+ +K I +++ ++ NR KV FGN SL H + Y+T
Sbjct: 2631 NFFVFIYYFFIKGYISLVL---VNINRALKYFKKVFLLLLFFFGNPMCSLNSHPFLVYVT 2687
Query: 134 VILYCKNI 111
ILYC +
Sbjct: 2688 YILYCLTV 2695
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 314,801,765
Number of Sequences: 1657284
Number of extensions: 5317100
Number of successful extensions: 10719
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 10308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10705
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 24771286585
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -