BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0004_E15
(561 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014296-3341|AAF51581.1| 900|Drosophila melanogaster CG5528-PA... 29 5.7
>AE014296-3341|AAF51581.1| 900|Drosophila melanogaster CG5528-PA
protein.
Length = 900
Score = 28.7 bits (61), Expect = 5.7
Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)
Frame = -2
Query: 155 VLDKFVYE*FRRYYELLII----ILSNWCRFYQSD*KHDT*EVCELHLGILFL 9
+LD + R Y +LII +LS+WC+F +H EV + HL ++FL
Sbjct: 794 ILDNIISCMDRSYSLMLIISSKFLLSHWCQFEMYLAQHRIFEVSKEHLILVFL 846
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,368,970
Number of Sequences: 53049
Number of extensions: 381737
Number of successful extensions: 858
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 840
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 858
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2172596895
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -