SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0004_D07
         (209 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000499F7D Cluster: hypothetical protein 13.t00045; ...    33   1.3  

>UniRef50_UPI0000499F7D Cluster: hypothetical protein 13.t00045;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 13.t00045 - Entamoeba histolytica HM-1:IMSS
          Length = 418

 Score = 33.1 bits (72), Expect = 1.3
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +2

Query: 11  AIAPPEDENNKWVRAFRKENSD*NKTKLNFSKTKHLKAIRNY*QVNLK 154
           A+   E+E NK +  +++EN+D N+ K    KT++ K +  Y  + L+
Sbjct: 297 ALITKEEETNKKILEYKEENNDMNEIKKLLKKTQNEKKVLEYEIIKLR 344


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 198,893,813
Number of Sequences: 1657284
Number of extensions: 2768514
Number of successful extensions: 7325
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7247
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7324
length of database: 575,637,011
effective HSP length: 48
effective length of database: 496,087,379
effective search space used: 10417834959
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -