Samia BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0004_C24
         (107 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF016420-7|AAB65303.1|  428|Caenorhabditis elegans Serpentine re...    25   5.4  
AC006630-3|AAK68325.1|  257|Caenorhabditis elegans Hypothetical ...    25   5.4  

>AF016420-7|AAB65303.1|  428|Caenorhabditis elegans Serpentine
           receptor, class r protein8 protein.
          Length = 428

 Score = 25.4 bits (53), Expect = 5.4
 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = -2

Query: 106 GYFSSVPLGGWXEVGLVPN-CLQLRGIXLVARAA 8
           G+  S+ L GW + GL+P  C +L  + ++ +AA
Sbjct: 129 GFVFSLCLFGWTKNGLIPKFCKRLVRVRMLRQAA 162


>AC006630-3|AAK68325.1|  257|Caenorhabditis elegans Hypothetical
           protein F14H12.3 protein.
          Length = 257

 Score = 25.4 bits (53), Expect = 5.4
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 66  WASCRIACSSGGS 28
           W++C + C SGGS
Sbjct: 148 WSACSVTCGSGGS 160


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,776,427
Number of Sequences: 27780
Number of extensions: 28768
Number of successful extensions: 141
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 141
length of database: 12,740,198
effective HSP length: 17
effective length of database: 12,267,938
effective search space used: 220822884
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)