BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0004_C17
(433 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 23 4.6
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 22 8.1
>DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor
protein.
Length = 344
Score = 23.0 bits (47), Expect = 4.6
Identities = 13/41 (31%), Positives = 21/41 (51%)
Frame = -3
Query: 158 IVNNIVSIIFYCSEIINLQFISACQNKLSYNTYTHDFN*SF 36
++ + I Y S I L ++S C N L YN ++ F +F
Sbjct: 305 LILKLFIITTYISGI--LYYLSTCINPLLYNIMSNKFRQAF 343
>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
Length = 1356
Score = 22.2 bits (45), Expect = 8.1
Identities = 8/10 (80%), Positives = 9/10 (90%)
Frame = -2
Query: 204 TIFGLFWYSL 175
TIFG+FW SL
Sbjct: 14 TIFGVFWASL 23
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 427,985
Number of Sequences: 2352
Number of extensions: 8970
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 35717724
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -