Samia BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0003_L24
         (565 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D26350-1|BAA05384.1| 2701|Homo sapiens type 2 inositol 1,4,5-tri...    30   4.9  

>D26350-1|BAA05384.1| 2701|Homo sapiens type 2 inositol
            1,4,5-trisphosphate receptor protein.
          Length = 2701

 Score = 30.3 bits (65), Expect = 4.9
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 7/73 (9%)
 Frame = +3

Query: 54   ILDVFGSPIKDFKETFSS--DSGLNKTNTAFAFSSMNTSV-----STIKSTMIEVPPNAE 212
            ILD+  +P+  + E  S   D G N   T      M T +     S    ++ +VPP+  
Sbjct: 892  ILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIH 951

Query: 213  SCKQGTYLDHTGV 251
              KQG+  +H  V
Sbjct: 952  PSKQGSPTEHEDV 964


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,817,903
Number of Sequences: 237096
Number of extensions: 1339258
Number of successful extensions: 2837
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2734
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2837
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5703349406
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)