Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0003_J21
         (495 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-3106|AAF50837.1| 1713|Drosophila melanogaster CG1718-PA...    28   6.0  

>AE014298-3106|AAF50837.1| 1713|Drosophila melanogaster CG1718-PA
            protein.
          Length = 1713

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
 Frame = +3

Query: 273  CLRDSANINLLF*INASSEGSFQAKRLPQFVA-FYLWIFWLTFHVCLVSWYIYSYLLK*L 449
            C+   ++I +LF I    E   +AK L QFV    +W FWL+  +C  + YI + L+  +
Sbjct: 1096 CMCFVSSIYILFLIK---ERESRAKLL-QFVGGVKVWTFWLSQFICDFASYIVTALIVVI 1151

Query: 450  TSFTFK 467
            T   F+
Sbjct: 1152 TIVCFQ 1157


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,617,878
Number of Sequences: 53049
Number of extensions: 383615
Number of successful extensions: 636
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 630
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 636
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1742533632
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)