SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0003_G20
         (384 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch...    47   1e-06
SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A...    29   0.25 
SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S...    29   0.25 
SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|...    29   0.25 
SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub...    29   0.25 
SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc...    29   0.25 
SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2...    29   0.25 
SPBC776.15c |||dihydrolipoamide S-succinyltransferase, e2 compon...    25   5.4  

>SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 312

 Score = 46.8 bits (106), Expect = 1e-06
 Identities = 25/72 (34%), Positives = 33/72 (45%)
 Frame = -1

Query: 384 FKNLLAIAAVTEVDFKEATTIKEYIKDPSKFVXXXXXXXXXXXXXXXXXXXXXXXXXXES 205
           +KNL+A++  TE  F+     K ++ DPS FV                          E 
Sbjct: 243 YKNLVAVSLATEYTFEGTEQTKAFLADPSAFV--VAAAPAAAAGGEAEAPAAEAAAEEEE 300

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 301 ESDEDMGFGLFD 312


>SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 110

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 99  ESDEDMGFGLFD 110


>SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein
           Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 110

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 99  ESDEDMGFGLFD 110


>SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein
           Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 109

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 98  ESDEDMGFGLFD 109


>SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 110

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 99  ESDEDMGFGLFD 110


>SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein
           Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 109

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 98  ESDEDMGFGLFD 109


>SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2C
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 110

 Score = 29.1 bits (62), Expect = 0.25
 Identities = 11/12 (91%), Positives = 12/12 (100%)
 Frame = -1

Query: 204 ESDDDMGFGLFD 169
           ESD+DMGFGLFD
Sbjct: 99  ESDEDMGFGLFD 110


>SPBC776.15c |||dihydrolipoamide S-succinyltransferase, e2 component
           of oxoglutarate dehydrogenase complex
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 452

 Score = 24.6 bits (51), Expect = 5.4
 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 4/24 (16%)
 Frame = -1

Query: 348 VDFKEATT----IKEYIKDPSKFV 289
           VD +EA T    +KEYI+DP+K +
Sbjct: 427 VDGREAVTFLRLVKEYIEDPAKML 450


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,060,331
Number of Sequences: 5004
Number of extensions: 14007
Number of successful extensions: 34
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 33
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 2,362,478
effective HSP length: 65
effective length of database: 2,037,218
effective search space used: 126307516
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -