Samia BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0003_E20
         (167 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0094 + 779097-779155,779882-781019,781732-782115,782842-78...    25   6.2  

>06_01_0094 +
           779097-779155,779882-781019,781732-782115,782842-783060
          Length = 599

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%)
 Frame = +2

Query: 11  CESWECVLTSC**L-KLQFTKHCLKMLIPKVNKFRGLLK 124
           C SW   L+S   +    F   CLK+  P +   R LLK
Sbjct: 77  CHSWRAALSSFPSVYTFNFPPLCLKLNTPNIRPLRVLLK 115


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,374,534
Number of Sequences: 37544
Number of extensions: 40509
Number of successful extensions: 97
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 97
length of database: 14,793,348
effective HSP length: 36
effective length of database: 13,441,764
effective search space used: 255393516
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)