BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= S06A01NCLL0003_D18
(353 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF080131-1|AAD19341.1| 312|Drosophila melanogaster ribosomal pr... 27 6.9
>AF080131-1|AAD19341.1| 312|Drosophila melanogaster ribosomal
protein L22 protein.
Length = 312
Score = 27.1 bits (57), Expect = 6.9
Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
Frame = +3
Query: 6 RVIMNGTFETSNNVVGFIKC-VPLTVSLSLY*NISLLFVNVTNLTYLKKEGFN*RIRIVN 182
R+ +NG N V F + + LTVS ++ S ++ YLKK IR+V
Sbjct: 231 RLKVNGKVNNLGNNVTFERSKLKLTVSSDVH--FSKAYLKYLTKKYLKKNSLRDWIRVVA 288
Query: 183 NPGDNVVILY 212
N D+ + Y
Sbjct: 289 NEKDSYELRY 298
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,657,906
Number of Sequences: 53049
Number of extensions: 199623
Number of successful extensions: 838
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 789
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 838
length of database: 24,988,368
effective HSP length: 76
effective length of database: 20,956,644
effective search space used: 859222404
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -