Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0003_A22
         (276 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    20   6.5  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    20   6.5  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    20   6.5  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    19   8.6  
AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex det...    19   8.6  

>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 19.8 bits (39), Expect = 6.5
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -2

Query: 152 IVIFLSPNNG 123
           + IF++PNNG
Sbjct: 128 VQIFIAPNNG 137


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 19.8 bits (39), Expect = 6.5
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -2

Query: 152 IVIFLSPNNG 123
           + IF++PNNG
Sbjct: 166 VQIFIAPNNG 175


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 19.8 bits (39), Expect = 6.5
 Identities = 10/37 (27%), Positives = 17/37 (45%)
 Frame = -2

Query: 113 YYITTV*MFHLYVHLFTYIIRTELKFRKRLVYVPASC 3
           +YI    M  +Y  +F    R  L+ R+   ++ A C
Sbjct: 211 FYIPLFVMIQVYYKIFCAARRIVLEERRAQSHLEAHC 247


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 19.4 bits (38), Expect = 8.6
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = +1

Query: 121 LPLLGDKNITI*QIMLKK 174
           +PL+ D+NI + Q+ L K
Sbjct: 199 VPLVVDENIELPQLQLVK 216


>AY569721-1|AAS86674.1|  400|Apis mellifera complementary sex
           determiner protein.
          Length = 400

 Score = 19.4 bits (38), Expect = 8.6
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -3

Query: 223 IVIALINVCNYS 188
           I+ +L N CNYS
Sbjct: 303 IISSLSNSCNYS 314


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,193
Number of Sequences: 438
Number of extensions: 1469
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 48
effective length of database: 125,319
effective search space used:  5388717
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)