Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_N14
         (442 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.              21   6.0  
DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II lar...    21   7.9  

>DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.
          Length = 135

 Score = 21.0 bits (42), Expect = 6.0
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +2

Query: 95  NELNQYLAERSYVSGYTPSQADIKVFEQVGK 187
           NE+NQ + E S +S         K+F+ + K
Sbjct: 95  NEINQLITECSAISDTNVHLKITKIFQCITK 125


>DQ069332-1|AAZ32217.1|  296|Apis mellifera RNA polymerase II large
           subunit protein.
          Length = 296

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 119 ERSYVSGYTPSQ 154
           E SY++G TPS+
Sbjct: 285 ENSYLAGLTPSE 296


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,793
Number of Sequences: 438
Number of extensions: 1982
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11450997
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)