Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= S06A01NCLL0002_L15
         (224 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    20   3.2  
AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    20   4.3  
DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    19   5.7  
DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholi...    19   9.9  
AF393497-1|AAL60422.1|  143|Apis mellifera odorant binding prote...    19   9.9  

>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 20.2 bits (40), Expect = 3.2
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -3

Query: 204 TRIRAE*TQANSAFDAILNVIRASRQKALAQG--EQARLT 91
           T  +A+ T+  S  DAIL++IR    + L Q   +QA+ T
Sbjct: 172 TAYKADYTKI-STLDAILDIIRNMVPENLVQACFQQAQTT 210


>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 19.8 bits (39), Expect = 4.3
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +1

Query: 181 CLLRPYP 201
           CLL+PYP
Sbjct: 106 CLLQPYP 112


>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 19.4 bits (38), Expect = 5.7
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -2

Query: 106 TSTFDFSKRR 77
           TSTFDF K R
Sbjct: 23  TSTFDFWKSR 32


>DQ026031-1|AAY87890.1|  601|Apis mellifera nicotinic acetylcholine
           receptor alpha1subunit protein.
          Length = 601

 Score = 18.6 bits (36), Expect = 9.9
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +1

Query: 181 CLLRPYPG 204
           CL+ P+PG
Sbjct: 7   CLVAPFPG 14


>AF393497-1|AAL60422.1|  143|Apis mellifera odorant binding protein
           ASP5 protein.
          Length = 143

 Score = 18.6 bits (36), Expect = 9.9
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = -2

Query: 151 KCYTCKSPKGLSSGRTSTFDF 89
           +CYT    K L + +   FDF
Sbjct: 66  QCYTTCIMKLLRTFKNGNFDF 86


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 47,648
Number of Sequences: 438
Number of extensions: 694
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 46
effective length of database: 126,195
effective search space used:  3533460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)