BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= S06A01NCLL0002_K08 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 283 8e-77 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_13124| Best HMM Match : Collagen (HMM E-Value=2.3e-11) 29 2.4 SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) 29 3.2 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_52815| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_33019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 283 bits (693), Expect = 8e-77 Identities = 134/169 (79%), Positives = 149/169 (88%) Frame = -3 Query: 536 LDQDLKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLDEKDPKRLFEGNAXXXXXXXX 357 L+Q+LKIIGEYGLRNKREVWRVK TLA+IRKAARELLTL+EKDP+RLFEGNA Sbjct: 22 LNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRI 81 Query: 356 XXLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNI 177 LDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKSIHHAR+LIRQRHIRVRKQ+VN+ Sbjct: 82 GVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQLVNV 141 Query: 176 PSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLRKGQGGGATNDEEED 30 PSF+VRLDS KHIDFSL SP+GGGRPGRVKRKN++KGQGG DE+ED Sbjct: 142 PSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKKGQGGSGGEDEDED 190 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 41.9 bits (94), Expect = 3e-04 Identities = 28/123 (22%), Positives = 54/123 (43%) Frame = -3 Query: 530 QDLKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLDEKDPKRLFEGNAXXXXXXXXXX 351 +++K++ +Y ++ + + + I+ A ++ LD KDP R+ E Sbjct: 28 REVKVLRKYHIQKREDYTKYNKLSGLIKSLANKIKDLDPKDPYRV-EATEQILEKLHNMG 86 Query: 350 LDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNIPS 171 L + L + F RRL + +A+ + A I Q H+RV +V+ P+ Sbjct: 87 LISTKKNLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKDAVKYIEQGHVRVGPEVIMDPA 146 Query: 170 FIV 162 F+V Sbjct: 147 FLV 149 >SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2557 Score = 29.1 bits (62), Expect = 2.4 Identities = 32/133 (24%), Positives = 56/133 (42%), Gaps = 11/133 (8%) Frame = -3 Query: 500 LRNKREVWRVKYTLARIRKAARELLTLD--EKDPKR--LFEGNA----XXXXXXXXXXLD 345 L N E W + AR+R+ +L+ LD +KD KR + E A D Sbjct: 1180 LTNTAEAWTQEQREARLRELKDKLVALDPADKDQKRSVMLEAAAIKLVSRKAHLAKSRED 1239 Query: 344 EKQMKLDYVLGLKIEDF-LERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQ--VVNIP 174 ++ D V+ I D E+ +++ A + + I +++ HI R Q + N+ Sbjct: 1240 GSEVPRDEVMISLIADLQQEQDKESEGVLASMQEKDKDGLIALQKEHIAARAQDTLANVR 1299 Query: 173 SFIVRLDSGKHID 135 + + R + G D Sbjct: 1300 AVLTRGEEGVAAD 1312 >SB_13124| Best HMM Match : Collagen (HMM E-Value=2.3e-11) Length = 476 Score = 29.1 bits (62), Expect = 2.4 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 257 QP*TPESEDGAPRSPQSSNRAHNPVSSVSHQALRP*PDDVVEHCLQTIS*DPSRRVS--- 427 +P TP ++ + P +SN +HN ++ LR + V HC+ ++ SR VS Sbjct: 408 EPGTPGAKGESGGPPFASNASHNELNRTLCHTLRHSGSNTVTHCVTRVT-QLSRTVSRTV 466 Query: 428 TVHGQP 445 VH P Sbjct: 467 QVHKDP 472 >SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) Length = 1110 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = -2 Query: 237 SCPHLDQTEAYSCPQAGGEHSFVHRPPGLRQAH*LLSEVAVRRRPARSRQEE 82 S PHL+ YS P HSF+ L L +A+ ++ AR + +E Sbjct: 306 SHPHLEAVRTYSLPFESVNHSFLLANNSLTVPVTDLRHLAITKQQARQKDQE 357 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.3 bits (60), Expect = 4.2 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = -3 Query: 326 DYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNI-PSFIVRLDS 150 D + G++ D+ L K +A L QR + V K VV F+++ + Sbjct: 128 DTLRGVQKHDYARLNLDAPALKNPIALPFMRRHQLTPQRIMGVVKTVVQSNEQFVLQGNF 187 Query: 149 GKHIDFSLKSPFGGGRPGRVKRKN 78 H+ P+GGG+ G+ K+ + Sbjct: 188 HLHV-VRTHMPYGGGKRGKSKKNS 210 >SB_52815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +3 Query: 81 LPLDATGPAAAERRLQREVNVLAGVQADDERRNVHHLLADTNMPLSDQDAGM 236 LP T PAA + L +V + V+ + RN+H L N+ L+ D G+ Sbjct: 479 LPAATTVPAAGMQNLTPQVPIGKWVELREISRNIH--LLTGNLQLNRNDIGV 528 >SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 143 ACRSPGGR*TKECSPPACGHEYAS 214 A +PGGR EC P CG ++ S Sbjct: 530 AVLNPGGRCPIECQNPGCGIKFCS 553 >SB_33019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 27.1 bits (57), Expect = 9.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 266 TPESEDGAPRSPQSSNRAHNP 328 TPE + G PR+P+ S R +P Sbjct: 476 TPEMKRGKPRTPEKSRRRKSP 496 >SB_32568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1918 Score = 27.1 bits (57), Expect = 9.7 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = +3 Query: 102 PAAAERRLQREVNVLAGVQADDERRNVHHLLADTNMPLSDQDAGMMD*LRKTSLEHLSLK 281 P+ R EVN+L V E+ N+ HL+A ++ L QD + L + + + Sbjct: 1415 PSCFVRIYSSEVNILDAV----EKENLAHLMASMHLALRHQDGADKESGTHGHLTNTTFE 1470 Query: 282 TALQEVLNL 308 +++ +NL Sbjct: 1471 IFVEKFINL 1479 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,806,509 Number of Sequences: 59808 Number of extensions: 305701 Number of successful extensions: 779 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 778 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -